SCOPe 2.06: Domain d5j17a_: 5j17 A:

Lineage for d5j17a_ (5j17 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)

8. Domain d5j17a_: 5j17 A: [323642]
   automated match to d1rfaa_

Details for d5j17a_

PDB Entry: 5j17

PDB Description: solution structure of ras binding domain (rbd) of b-raf

PDB Compounds: (A:) Serine/threonine-protein kinase B-raf

SCOPe Domain Sequences for d5j17a_:

Sequence; same for both SEQRES and ATOM records:

>d5j17a_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqdgekkpigw
dtdiswltgeelhvevlenv

Timeline for d5j17a_:

• d5j17a_ is new in SCOPe 2.06-stable
  
• d5j17a_ appears in SCOPe 2.07
  
• d5j17a_ appears in the current release, SCOPe 2.08