Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
Protein Retroviral integrase, catalytic domain [53108] (4 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (73 PDB entries) |
Domain d5eu7b_: 5eu7 B: [323362] Other proteins in same PDB: d5eu7c1, d5eu7c2, d5eu7d1, d5eu7d2 automated match to d1bisa_ |
PDB Entry: 5eu7 (more details), 2.64 Å
SCOPe Domain Sequences for d5eu7b_:
Sequence, based on SEQRES records: (download)
>d5eu7b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktihtd ngsnftsttvkaacdwagikqefgipynpqsqgvvesmnkelkkiigqvrdqaehlktav qmavfihnkkrkggiggysagerivdiiatdiq
>d5eu7b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktihtd ngsnftsttvkaacdwagikqefgvvesmnkelkkiigqvrdqaehlktavqmavfihnk krkggiggysagerivdiiatdiq
Timeline for d5eu7b_: