Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d5eu7d2: 5eu7 D:108-213 [323274] Other proteins in same PDB: d5eu7a_, d5eu7b_, d5eu7c1, d5eu7d1 automated match to d4jg1l2 |
PDB Entry: 5eu7 (more details), 2.64 Å
SCOPe Domain Sequences for d5eu7d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eu7d2 b.1.1.2 (D:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d5eu7d2:
View in 3D Domains from other chains: (mouse over for more information) d5eu7a_, d5eu7b_, d5eu7c1, d5eu7c2 |