SCOPe 2.07: Domain d5chfe2: 5chf E:77-151

Lineage for d5chfe2 (5chf E:77-151)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (11 families)
Family d.15.1.0: automated matches [191343] (1 protein)
not a true family
Protein automated matches [190233] (31 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [189205] (16 PDB entries)
Domain d5chfe2: 5chf E:77-151 [323208]
automated match to d3pseb2
complexed with gol, so4

Details for d5chfe2

PDB Entry: 5chf (more details), 2.3 Å

PDB Description: crystal structure of murine isg15 in space group p21212

PDB Compounds: (E:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d5chfe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5chfe2 d.15.1.0 (E:77-151) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
seplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfwlsfegrpmedkellg
eyglkpqctvikhlr

SCOPe Domain Coordinates for d5chfe2:

Click to download the PDB-style file with coordinates for d5chfe2.
(The format of our PDB-style files is described here.)

Timeline for d5chfe2: