Lineage for d3pseb2 (3pse B:79-156)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2539528Protein automated matches [190118] (17 species)
    not a true protein
  7. 2539567Species Human (Homo sapiens) [TaxId:9606] [189560] (114 PDB entries)
  8. 2539632Domain d3pseb2: 3pse B:79-156 [233269]
    automated match to d1z2ma2
    complexed with 3cn, gol

Details for d3pseb2

PDB Entry: 3pse (more details), 2.3 Å

PDB Description: Structure of a viral OTU domain protease bound to interferon-stimulated gene 15 (ISG15)
PDB Compounds: (B:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d3pseb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pseb2 d.15.1.1 (B:79-156) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deplnilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplg
eyglkplstvfmnlrlrg

SCOPe Domain Coordinates for d3pseb2:

Click to download the PDB-style file with coordinates for d3pseb2.
(The format of our PDB-style files is described here.)

Timeline for d3pseb2: