Lineage for d5j9ca1 (5j9c A:3-168)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487984Species Neosartorya fumigata [TaxId:330879] [322976] (2 PDB entries)
  8. 2487985Domain d5j9ca1: 5j9c A:3-168 [322979]
    Other proteins in same PDB: d5j9ca2, d5j9cb2, d5j9cb3
    automated match to d4k7oc_
    complexed with mg

Details for d5j9ca1

PDB Entry: 5j9c (more details), 1.96 Å

PDB Description: crystal structure of peroxiredoxin asp f3 c31s/c61s variant
PDB Compounds: (A:) peroxiredoxin Asp f3

SCOPe Domain Sequences for d5j9ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j9ca1 c.47.1.0 (A:3-168) automated matches {Neosartorya fumigata [TaxId: 330879]}
glkagdsfpsdvvfsyipwsedkgeitasgipinynaskewadkkvilfalpgaftpvss
arhvpeyieklpeirakgvdvvavlayndayvmsawgkanqvtgddilflsdpdarfsks
igwadeegrtkryalvidhgkityaalepaknhlefssaetvlkhl

SCOPe Domain Coordinates for d5j9ca1:

Click to download the PDB-style file with coordinates for d5j9ca1.
(The format of our PDB-style files is described here.)

Timeline for d5j9ca1: