Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Neosartorya fumigata [TaxId:330879] [322976] (2 PDB entries) |
Domain d5j9ca1: 5j9c A:3-168 [322979] Other proteins in same PDB: d5j9ca2, d5j9cb2, d5j9cb3 automated match to d4k7oc_ complexed with mg |
PDB Entry: 5j9c (more details), 1.96 Å
SCOPe Domain Sequences for d5j9ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j9ca1 c.47.1.0 (A:3-168) automated matches {Neosartorya fumigata [TaxId: 330879]} glkagdsfpsdvvfsyipwsedkgeitasgipinynaskewadkkvilfalpgaftpvss arhvpeyieklpeirakgvdvvavlayndayvmsawgkanqvtgddilflsdpdarfsks igwadeegrtkryalvidhgkityaalepaknhlefssaetvlkhl
Timeline for d5j9ca1: