SCOPe 2.06: Domain d5eooc_: 5eoo C:

Lineage for d5eooc_ (5eoo C:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (40 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189201] (28 PDB entries)

8. Domain d5eooc_: 5eoo C: [322924]
   automated match to d4mxga_
   complexed with cit, cl, ipa, mrd, pge

Details for d5eooc_

PDB Entry: 5eoo, 1.48 Å

PDB Description: crystal structure of extended-spectrum beta-lactamase bel-1 (monoclinic form)

PDB Compounds: (C:) Beta-lactamase

SCOPe Domain Sequences for d5eooc_:

Sequence; same for both SEQRES and ATOM records:

>d5eooc_ e.3.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dfehaisdleahnqakigvalvsengnliqgyranerfamcstfklplaalvlsridage
enperklhydsafleeyapaakryvatgymtvteaiqsalqlsdnaaanlllkevggppl
ltkyfrslgdkvsrldrieptlntntpgderdtttpmsmaqtvsklifgdtltykskgql
rrllignqtgdktiraglpdswvtgdktgscanggrndvaffittagkkyvlsvytnape
lqgeeralliasvaklarqyv

Timeline for d5eooc_:

• d5eooc_ is new in SCOPe 2.06-stable
  
• d5eooc_ appears in SCOPe 2.07
  
• d5eooc_ appears in the current release, SCOPe 2.08