Lineage for d5kxea_ (5kxe A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052409Species Wisteria floribunda [TaxId:3922] [322647] (4 PDB entries)
  8. 2052418Domain d5kxea_: 5kxe A: [322662]
    automated match to d4u36a_
    complexed with 6y2, bma, ca, fuc, man, mn, nag, po4, so4, xyp

Details for d5kxea_

PDB Entry: 5kxe (more details), 2.09 Å

PDB Description: wisteria floribunda lectin in complex with galnac(beta1-4)glcnac (lacdinac) at ph 4.2
PDB Compounds: (A:) Wisteria floribunda agglutinin

SCOPe Domain Sequences for d5kxea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kxea_ b.29.1.0 (A:) automated matches {Wisteria floribunda [TaxId: 3922]}
kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps

SCOPe Domain Coordinates for d5kxea_:

Click to download the PDB-style file with coordinates for d5kxea_.
(The format of our PDB-style files is described here.)

Timeline for d5kxea_: