Lineage for d5g3le_ (5g3l E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2398373Protein automated matches [190381] (11 species)
    not a true protein
  7. 2398484Species Escherichia coli [TaxId:634468] [322555] (1 PDB entry)
  8. 2398486Domain d5g3le_: 5g3l E: [322583]
    Other proteins in same PDB: d5g3lf_, d5g3lg_
    automated match to d1qb5d_
    complexed with na, sia

Details for d5g3le_

PDB Entry: 5g3l (more details), 1.72 Å

PDB Description: escherichia coli heat labile enterotoxin type iib b-pentamer complexed with sialylated sugar
PDB Compounds: (E:) Heat-labile enterotoxin IIB, B chain

SCOPe Domain Sequences for d5g3le_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g3le_ b.40.2.1 (E:) automated matches {Escherichia coli [TaxId: 634468]}
gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiaxaavlsgmrvnmcaspasspnviwaieleae

SCOPe Domain Coordinates for d5g3le_:

Click to download the PDB-style file with coordinates for d5g3le_.
(The format of our PDB-style files is described here.)

Timeline for d5g3le_: