PDB entry 5g3l

View 5g3l on RCSB PDB site
Description: escherichia coli heat labile enterotoxin type iib b-pentamer complexed with sialylated sugar
Class: toxin
Keywords: toxin, enterotoxin, ecoli, b subunit, sialic acid
Deposited on 2016-04-29, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: ESCHERICHIA COLI [TaxId:634468]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g3ld_
  • Chain 'E':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: ESCHERICHIA COLI [TaxId:634468]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g3le_
  • Chain 'F':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: ESCHERICHIA COLI [TaxId:634468]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g3lf_
  • Chain 'G':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: ESCHERICHIA COLI [TaxId:634468]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g3lg_
  • Chain 'H':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: ESCHERICHIA COLI [TaxId:634468]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g3lh_
  • Heterogens: NA, SIA, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5g3lD (D:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiaxaavlsgmrvnmcaspasspnviwaieleae
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5g3lE (E:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiaxaavlsgmrvnmcaspasspnviwaieleae
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5g3lF (F:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5g3lG (G:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5g3lH (H:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiaxaavlsgmrvnmcaspasspnviwaieleae