Lineage for d5jjga_ (5jjg A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2324762Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2324763Protein automated matches [190513] (36 species)
    not a true protein
  7. 2324939Species Mouse (Mus musculus) [TaxId:10090] [255298] (5 PDB entries)
  8. 2324941Domain d5jjga_: 5jjg A: [322358]
    automated match to d3aaja_
    complexed with ipa, mg

Details for d5jjga_

PDB Entry: 5jjg (more details), 1.72 Å

PDB Description: structure of magnesium-loaded alg-2
PDB Compounds: (A:) Pcalcium-binding protein ALG-2, rogrammed cell death protein 6

SCOPe Domain Sequences for d5jjga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jjga_ a.39.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dqsflwnvfqrvdkdrsgvisdnelqqalsngtwtpfnpvtvrsiismfdrenkagvnfs
eftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgr
gqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv

SCOPe Domain Coordinates for d5jjga_:

Click to download the PDB-style file with coordinates for d5jjga_.
(The format of our PDB-style files is described here.)

Timeline for d5jjga_: