Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (36 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [255298] (5 PDB entries) |
Domain d5jjga_: 5jjg A: [322358] automated match to d3aaja_ complexed with ipa, mg |
PDB Entry: 5jjg (more details), 1.72 Å
SCOPe Domain Sequences for d5jjga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jjga_ a.39.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dqsflwnvfqrvdkdrsgvisdnelqqalsngtwtpfnpvtvrsiismfdrenkagvnfs eftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgr gqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
Timeline for d5jjga_: