Lineage for d1daka_ (1dak A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 988943Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 989038Protein Dethiobiotin synthetase [52653] (1 species)
  7. 989039Species Escherichia coli [TaxId:562] [52654] (13 PDB entries)
  8. 989041Domain d1daka_: 1dak A: [32203]
    complexed with adp, dpu, mg, po4

Details for d1daka_

PDB Entry: 1dak (more details), 1.6 Å

PDB Description: dethiobiotin synthetase from escherichia coli, complex reaction intermediate adp and mixed anhydride
PDB Compounds: (A:) dethiobiotin synthetase

SCOPe Domain Sequences for d1daka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1daka_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}
skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall

SCOPe Domain Coordinates for d1daka_:

Click to download the PDB-style file with coordinates for d1daka_.
(The format of our PDB-style files is described here.)

Timeline for d1daka_: