Lineage for d5db5a_ (5db5 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2147545Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2147739Protein NifS-like protein/selenocysteine lyase [53412] (3 species)
  7. 2147746Species Escherichia coli [TaxId:668369] [321684] (1 PDB entry)
  8. 2147747Domain d5db5a_: 5db5 A: [321749]
    automated match to d1jf9a_
    complexed with cit, cys, edo, plp

Details for d5db5a_

PDB Entry: 5db5 (more details), 2.75 Å

PDB Description: crystal structure of plp-bound e. coli sufs (cysteine persulfide intermediate) in space group p21
PDB Compounds: (A:) Cysteine desulfurase

SCOPe Domain Sequences for d5db5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5db5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 668369]}
fsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgihtls
aqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqme
hhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgtenp
laemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvkeal
lqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalglnni
aeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrtgh
hcamplmayynvpamcraslamyntheevdrlvtglqrihrllg

SCOPe Domain Coordinates for d5db5a_:

Click to download the PDB-style file with coordinates for d5db5a_.
(The format of our PDB-style files is described here.)

Timeline for d5db5a_: