SCOPe 2.06: Domain d5j5da_: 5j5d A:

Lineage for d5j5da_ (5j5d A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (24 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [321362] (1 PDB entry)

8. Domain d5j5da_: 5j5d A: [321363]
   automated match to d3l21a_
   complexed with 6gt, na

Details for d5j5da_

PDB Entry: 5j5d, 2.4 Å

PDB Description: crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid

PDB Compounds: (A:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d5j5da_:

Sequence; same for both SEQRES and ATOM records:

>d5j5da_ c.1.10.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
vgfdvaarlgtlltamvtpfsgdgsldtataarlanhlvdqgcdglvvsgttgesptttd
gekiellravleavgdrarviagagtydtahsirlakacaaegahgllvvtpyyskppqr
glqahftavadatelpmllydipgrsavpiepdtiralashpnivgvkdakadlhsgaqi
madtglayysgddalnlpwlamgatgfisviahlaagqlrellsafgsgdiatarkinia
vaplcnamsrlggvtlskaglrlqgidvgdprlpqvaatpeqidalaadmraasvlr

Timeline for d5j5da_:

• d5j5da_ is new in SCOPe 2.06-stable
  
• d5j5da_ appears in SCOPe 2.07
  
• d5j5da_ appears in the current release, SCOPe 2.08