Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (24 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [321362] (1 PDB entry) |
Domain d5j5da_: 5j5d A: [321363] automated match to d3l21a_ complexed with 6gt, na |
PDB Entry: 5j5d (more details), 2.4 Å
SCOPe Domain Sequences for d5j5da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j5da_ c.1.10.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} vgfdvaarlgtlltamvtpfsgdgsldtataarlanhlvdqgcdglvvsgttgesptttd gekiellravleavgdrarviagagtydtahsirlakacaaegahgllvvtpyyskppqr glqahftavadatelpmllydipgrsavpiepdtiralashpnivgvkdakadlhsgaqi madtglayysgddalnlpwlamgatgfisviahlaagqlrellsafgsgdiatarkinia vaplcnamsrlggvtlskaglrlqgidvgdprlpqvaatpeqidalaadmraasvlr
Timeline for d5j5da_: