SCOPe 2.07: Domain d5j8xa2: 5j8x A:263-358

Lineage for d5j8xa2 (5j8x A:263-358)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families)

5. Family b.105.1.0: automated matches [231757] (1 protein)
   not a true family

6. Protein automated matches [231758] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [321360] (1 PDB entry)

8. Domain d5j8xa2: 5j8x A:263-358 [321361]
   Other proteins in same PDB: d5j8xa1
   automated match to d1hd8a1
   complexed with ok3

Details for d5j8xa2

PDB Entry: 5j8x, 2.53 Å

PDB Description: crystal structure of e. coli pbp5 with 2c

PDB Compounds: (A:) D-alanyl-D-alanine carboxypeptidase dacA

SCOPe Domain Sequences for d5j8xa2:

Sequence; same for both SEQRES and ATOM records:

>d5j8xa2 b.105.1.0 (A:263-358) automated matches {Escherichia coli [TaxId: 83333]}
fetvnplkvgkefasepvwfgdsdraslgvdkdvyltiprgrmkdlkasyvlnsselhap
lqknqvvgtinfqldgktieqrplvvlqeipegnff

Timeline for d5j8xa2:

• d5j8xa2 first appeared in SCOPe 2.06
  
• d5j8xa2 appears in the current release, SCOPe 2.08