Lineage for d1efua3 (1efu A:9-204)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179429Family c.37.1.8: G proteins [52592] (26 proteins)
  6. 179540Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 179546Species Escherichia coli [TaxId:562] [52627] (6 PDB entries)
  8. 179553Domain d1efua3: 1efu A:9-204 [32115]
    Other proteins in same PDB: d1efua1, d1efua2, d1efub2, d1efub3, d1efub4, d1efuc1, d1efuc2, d1efud2, d1efud3, d1efud4

Details for d1efua3

PDB Entry: 1efu (more details), 2.5 Å

PDB Description: elongation factor complex ef-tu/ef-ts from escherichia coli

SCOP Domain Sequences for d1efua3:

Sequence, based on SEQRES records: (download)

>d1efua3 c.37.1.8 (A:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
lelagfldsyipeper

Sequence, based on observed residues (ATOM records): (download)

>d1efua3 c.37.1.8 (A:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
kphvnvgtighvdhgkttltaaittvlaktyggatshveydtptrhyahvdcpghadyvk
nmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelv
emevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeper

SCOP Domain Coordinates for d1efua3:

Click to download the PDB-style file with coordinates for d1efua3.
(The format of our PDB-style files is described here.)

Timeline for d1efua3: