Lineage for d5d0ga1 (5d0g A:106-269)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197663Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2197744Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2197745Protein automated matches [191274] (12 species)
    not a true protein
  7. 2197760Species Mycobacterium avium [TaxId:1391991] [320949] (4 PDB entries)
  8. 2197765Domain d5d0ga1: 5d0g A:106-269 [320982]
    Other proteins in same PDB: d5d0ga2, d5d0gb2
    automated match to d2w01b_
    complexed with ca, gtp; mutant

Details for d5d0ga1

PDB Entry: 5d0g (more details), 1.6 Å

PDB Description: crystal structure of triple mutant (kda to egy) of adenylyl cyclase ma1120 from mycobacterium avium in complex with gtp and calcium ion
PDB Compounds: (A:) Cyclase

SCOPe Domain Sequences for d5d0ga1:

Sequence, based on SEQRES records: (download)

>d5d0ga1 d.58.29.0 (A:106-269) automated matches {Mycobacterium avium [TaxId: 1391991]}
rvvilftdieestalnerigdrawvklisshdklvsdlvrrqsghvvesqgdgfmvafar
peqavrcgielqralrrnanrkrheeirvrigihmgrsvrrgdglfgrnvamayrvaaqa
aggeilvsqpvrdalsrsdgirfddgrevelkgfsgtyrlfavl

Sequence, based on observed residues (ATOM records): (download)

>d5d0ga1 d.58.29.0 (A:106-269) automated matches {Mycobacterium avium [TaxId: 1391991]}
rvvilftdieestalnerigdrawvklisshdklvsdlvrrqsghvvesqgdgfmvafar
peqavrcgielqralrrnaeirvrigihmgrsvrrgdglfgrnvamayrvaaqaaggeil
vsqpvrdalsrsdgirfddgrevelkgfsgtyrlfavl

SCOPe Domain Coordinates for d5d0ga1:

Click to download the PDB-style file with coordinates for d5d0ga1.
(The format of our PDB-style files is described here.)

Timeline for d5d0ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5d0ga2