SCOPe 2.07: Domain d5jhrb_: 5jhr B:

Lineage for d5jhrb_ (5jhr B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d5jhrb_: 5jhr B: [320486]
   Other proteins in same PDB: d5jhra_, d5jhrc_, d5jhrd_, d5jhre_, d5jhrg_, d5jhri_, d5jhrj_, d5jhrk_, d5jhrl_, d5jhrn_, d5jhro_, d5jhrq_, d5jhrr_, d5jhrs_, d5jhru_, d5jhrw_, d5jhrx_, d5jhry_, d5jhrz_
   automated match to d1z7qc1
   complexed with 6kf, cl, mes, mg

Details for d5jhrb_

PDB Entry: 5jhr, 2.9 Å

PDB Description: yeast 20s proteasome in complex with the peptidic epoxyketone inhibitor 27

PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d5jhrb_:

Sequence; same for both SEQRES and ATOM records:

>d5jhrb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

Timeline for d5jhrb_:

• d5jhrb_ first appeared in SCOPe 2.06
  
• d5jhrb_ appears in the current release, SCOPe 2.08