SCOPe 2.07: Domain d5jhrz_: 5jhr Z:

Lineage for d5jhrz_ (5jhr Z:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d5jhrz_: 5jhr Z: [320428]
   Other proteins in same PDB: d5jhrb_, d5jhrc_, d5jhrd_, d5jhre_, d5jhrf_, d5jhrg_, d5jhrh_, d5jhrm_, d5jhrp_, d5jhrq_, d5jhrr_, d5jhrs_, d5jhrt_, d5jhru_, d5jhrv_
   automated match to d1rypm_
   complexed with 6kf, cl, mes, mg

Details for d5jhrz_

PDB Entry: 5jhr, 2.9 Å

PDB Description: yeast 20s proteasome in complex with the peptidic epoxyketone inhibitor 27

PDB Compounds: (Z:) Proteasome subunit beta type-6

SCOPe Domain Sequences for d5jhrz_:

Sequence; same for both SEQRES and ATOM records:

>d5jhrz_ d.153.1.4 (Z:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

Timeline for d5jhrz_:

• d5jhrz_ first appeared in SCOPe 2.06
  
• d5jhrz_ appears in the current release, SCOPe 2.08