Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (40 species) not a true protein |
Species Escherichia coli [TaxId:562] [225496] (14 PDB entries) |
Domain d5chma_: 5chm A: [320363] automated match to d2wzxa_ complexed with act, cb4, na, zn |
PDB Entry: 5chm (more details), 1.9 Å
SCOPe Domain Sequences for d5chma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5chma_ e.3.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} pltatvdgiiqpmlkayripgmavavlkdgkahyfnygvanresgqrvseqtlfeigsvs ktltatlgayaavkggfelddkvsqhapwlkgsafdgvtmaelatysagglplqfpdevd sndkmqtyyrswspvypagthrqysnpsiglfghlaanslgqpfeqlmsqtllpklglhh tyiqvpesamanyaygyskedkpiratpgvlaaeaygiktgsadllkfveanmgyqgdaa lksaialthtgfhsvgemtqglgwesydypvteqvllagnspavsfqanpvtrfavpkam geqrlynktgstggfgayvafvpargiaivmlanrnypiearvkaahailsqlae
Timeline for d5chma_: