SCOPe 2.06: Domain d5chma_: 5chm A:

Lineage for d5chma_ (5chm A:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (40 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [225496] (14 PDB entries)

8. Domain d5chma_: 5chm A: [320363]
   automated match to d2wzxa_
   complexed with act, cb4, na, zn

Details for d5chma_

PDB Entry: 5chm, 1.9 Å

PDB Description: crystal structure of fox-4 cephamycinase complexed with ceftazidime batsi (lp06)

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5chma_:

Sequence; same for both SEQRES and ATOM records:

>d5chma_ e.3.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
pltatvdgiiqpmlkayripgmavavlkdgkahyfnygvanresgqrvseqtlfeigsvs
ktltatlgayaavkggfelddkvsqhapwlkgsafdgvtmaelatysagglplqfpdevd
sndkmqtyyrswspvypagthrqysnpsiglfghlaanslgqpfeqlmsqtllpklglhh
tyiqvpesamanyaygyskedkpiratpgvlaaeaygiktgsadllkfveanmgyqgdaa
lksaialthtgfhsvgemtqglgwesydypvteqvllagnspavsfqanpvtrfavpkam
geqrlynktgstggfgayvafvpargiaivmlanrnypiearvkaahailsqlae

Timeline for d5chma_:

• d5chma_ is new in SCOPe 2.06-stable
  
• d5chma_ appears in SCOPe 2.07
  
• d5chma_ appears in the current release, SCOPe 2.08