Class b: All beta proteins [48724] (178 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188766] (28 PDB entries) |
Domain d5dvxa_: 5dvx A: [320311] automated match to d3iaib_ complexed with cl, gol, trs, zn |
PDB Entry: 5dvx (more details), 1.6 Å
SCOPe Domain Sequences for d5dvxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dvxa_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hwryggdppwprvspacagrfqspvdirpqlaafspalrplelsgfqlpplpelrlrnng hsvqltlppglemklgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstky arvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallps dfsryfqyegslttppcaqgviwtvfnqtvslsakqlhtlsdtlwgpgdsrlqlnfratq plngrvieasfpagvdsspr
Timeline for d5dvxa_: