SCOPe 2.08: Domain d5dvxa_: 5dvx A:

Lineage for d5dvxa_ (5dvx A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.0: automated matches [191576] (1 protein)
   not a true family

6. Protein automated matches [191011] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188766] (28 PDB entries)

8. Domain d5dvxa_: 5dvx A: [320311]
   automated match to d3iaib_
   complexed with cl, gol, trs, zn

Details for d5dvxa_

PDB Entry: 5dvx, 1.6 Å

PDB Description: crystal structure of the catalytic-domain of human carbonic anhydrase ix at 1.6 angstrom resolution

PDB Compounds: (A:) Carbonic anhydrase 9

SCOPe Domain Sequences for d5dvxa_:

Sequence; same for both SEQRES and ATOM records:

>d5dvxa_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hwryggdppwprvspacagrfqspvdirpqlaafspalrplelsgfqlpplpelrlrnng
hsvqltlppglemklgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstky
arvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallps
dfsryfqyegslttppcaqgviwtvfnqtvslsakqlhtlsdtlwgpgdsrlqlnfratq
plngrvieasfpagvdsspr

Timeline for d5dvxa_:

• d5dvxa_ first appeared in SCOPe 2.06
  
• d5dvxa_ appears in SCOPe 2.07