Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries) |
Domain d4zhqa2: 4zhq A:246-439 [320211] Other proteins in same PDB: d4zhqa1, d4zhqb1, d4zhqb2, d4zhqc1, d4zhqd1, d4zhqd2, d4zhqe_, d4zhqf1, d4zhqf2, d4zhqf3 automated match to d4i50a2 complexed with 4q5, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4zhq (more details), 2.55 Å
SCOPe Domain Sequences for d4zhqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zhqa2 d.79.2.1 (A:246-439) automated matches {Pig (Sus scrofa) [TaxId: 9823]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvds
Timeline for d4zhqa2: