Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (158 PDB entries) |
Domain d4zhqf2: 4zhq F:77-378 [320172] Other proteins in same PDB: d4zhqa1, d4zhqa2, d4zhqb1, d4zhqb2, d4zhqc1, d4zhqc2, d4zhqd1, d4zhqd2, d4zhqe_, d4zhqf1, d4zhqf3 automated match to d3tiia2 complexed with 4q5, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4zhq (more details), 2.55 Å
SCOPe Domain Sequences for d4zhqf2:
Sequence, based on SEQRES records: (download)
>d4zhqf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d4zhqf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptntderevflaaynrrregregnvwiakgiliss easelldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrts sepynsanfqdktchltnhciqkeynygryeegnemffeefnqylmdalnttlensillq ikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyael cqgivdvaissvfpladtsifikl
Timeline for d4zhqf2: