Lineage for d4zi7b2 (4zi7 B:246-440)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959185Protein Tubulin beta-subunit [55313] (2 species)
  7. 2959197Species Pig (Sus scrofa) [TaxId:9823] [55314] (9 PDB entries)
  8. 2959204Domain d4zi7b2: 4zi7 B:246-440 [320164]
    Other proteins in same PDB: d4zi7a1, d4zi7a2, d4zi7b1, d4zi7c1, d4zi7c2, d4zi7d1, d4zi7e_, d4zi7f1, d4zi7f2, d4zi7f3
    automated match to d1sa0b2
    complexed with 4sl, acp, ca, gdp, gol, gtp, mes, mg

Details for d4zi7b2

PDB Entry: 4zi7 (more details), 2.51 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-hti286 complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d4zi7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zi7b2 d.79.2.1 (B:246-440) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdata

SCOPe Domain Coordinates for d4zi7b2:

Click to download the PDB-style file with coordinates for d4zi7b2.
(The format of our PDB-style files is described here.)

Timeline for d4zi7b2: