SCOPe 2.06: Domain d5ccsx_: 5ccs X:

Lineage for d5ccsx_ (5ccs X:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186915] (20 PDB entries)

8. Domain d5ccsx_: 5ccs X: [319835]
   automated match to d1w8ma_
   complexed with c4y

Details for d5ccsx_

PDB Entry: 5ccs, 2.1 Å

PDB Description: human cyclophilin d complexed with inhibitor

PDB Compounds: (X:) Peptidyl-prolyl cis-trans isomerase F, mitochondrial

SCOPe Domain Sequences for d5ccsx_:

Sequence; same for both SEQRES and ATOM records:

>d5ccsx_ b.62.1.1 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
ldgqhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls

Timeline for d5ccsx_:

• d5ccsx_ is new in SCOPe 2.06-stable
  
• d5ccsx_ appears in SCOPe 2.07
  
• d5ccsx_ appears in the current release, SCOPe 2.08