SCOPe 2.06: Domain d5iy0f1: 5iy0 F:2-252

Lineage for d5iy0f1 (5iy0 F:2-252)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (33 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:186497] [238494] (2 PDB entries)

8. Domain d5iy0f1: 5iy0 F:2-252 [319529]
   Other proteins in same PDB: d5iy0a2, d5iy0b2, d5iy0c2, d5iy0d2, d5iy0e2, d5iy0f2
   automated match to d1ltle_
   complexed with zn

Details for d5iy0f1

PDB Entry: 5iy0, 3 Å

PDB Description: pfmcm n-terminal domain double hexamer

PDB Compounds: (F:) Cell division control protein 21

SCOPe Domain Sequences for d5iy0f1:

Sequence; same for both SEQRES and ATOM records:

>d5iy0f1 b.40.4.0 (F:2-252) automated matches {Pyrococcus furiosus [TaxId: 186497]}
dreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahevi
enpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqvegi
vtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssfvn
fqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpifr
kilevnhiepv

Timeline for d5iy0f1:

• d5iy0f1 is new in SCOPe 2.06-stable
  
• d5iy0f1 appears in SCOPe 2.07
  
• d5iy0f1 appears in the current release, SCOPe 2.08