SCOPe 2.06: Domain d5ke4a1: 5ke4 A:1-207

Lineage for d5ke4a1 (5ke4 A:1-207)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (6 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)

8. Domain d5ke4a1: 5ke4 A:1-207 [319365]
   Other proteins in same PDB: d5ke4a2, d5ke4b2, d5ke4c2, d5ke4d2, d5ke4e2
   automated match to d2w8gc_
   complexed with 6s7

Details for d5ke4a1

PDB Entry: 5ke4, 2.55 Å

PDB Description: crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing loop c from the human alpha 6 nicotinic acetylcholine receptor in complex with 2-((5-(3,7- diazabicyclo[3.3.1]nonan-3-yl)pyridin-3-yl)oxy)- n,n- dimethylethanamine (bpc)

PDB Compounds: (A:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5ke4a1:

Sequence, based on SEQRES records:

>d5ke4a1 b.96.1.0 (A:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtkhdikyncceeiytdvnlvvkfrer

Sequence, based on observed residues (ATOM records):

>d5ke4a1 b.96.1.0 (A:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklns
lmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrls
fmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtkh
dikyncceeiytdvnlvvkfrer

Timeline for d5ke4a1:

• d5ke4a1 is new in SCOPe 2.06-stable
  
• d5ke4a1 appears in SCOPe 2.07
  
• d5ke4a1 appears in the current release, SCOPe 2.08