Lineage for d5hvtc_ (5hvt C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2202456Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2202457Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2202651Family d.80.1.3: MIF-related [55339] (2 proteins)
    automatically mapped to Pfam PF01187
  6. 2202668Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 2202674Species Human (Homo sapiens) [TaxId:9606] [55341] (71 PDB entries)
  8. 2202803Domain d5hvtc_: 5hvt C: [319047]
    automated match to d1ljta_
    complexed with gol, ipa, nvs, so4

Details for d5hvtc_

PDB Entry: 5hvt (more details), 1.75 Å

PDB Description: crystal structure of macrophage migration inhibitory factor (mif) with a potent inhibitor (nvs-2)
PDB Compounds: (C:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d5hvtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hvtc_ d.80.1.3 (C:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

SCOPe Domain Coordinates for d5hvtc_:

Click to download the PDB-style file with coordinates for d5hvtc_.
(The format of our PDB-style files is described here.)

Timeline for d5hvtc_: