Lineage for d5c54h_ (5c54 H:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2444836Species Corynebacterium glutamicum [TaxId:196627] [318685] (2 PDB entries)
  8. 2444844Domain d5c54h_: 5c54 H: [318871]
    automated match to d3lera_
    complexed with gol

Details for d5c54h_

PDB Entry: 5c54 (more details), 1.6 Å

PDB Description: crystal structure of a novel n-acetylneuraminic acid lyase from corynebacterium glutamicum
PDB Compounds: (H:) Dihydrodipicolinate synthase/N-acetylneuraminate lyase

SCOPe Domain Sequences for d5c54h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c54h_ c.1.10.0 (H:) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
satftgvippvmtplhadgsvdveslrklvdhlinggvdglfalgssgeaafltraqrkl
alttiiehtagrvpvtagvietttarvielvedaleagaeglvatapfytrthdveieeh
frkihaaapelplfaynipvsvhsnlnpvmlltlakdgvlagtkdssgndgairsliear
ddaglteqfkiltgsettvdfaylagadgvvpglgnvdpaayaalaklcldgkwaeaaal
qkrinhlfhivfvgdtshmsgssaglggfktalahlgiiesnamavphqslsdeetarih
aivdeflyta

SCOPe Domain Coordinates for d5c54h_:

Click to download the PDB-style file with coordinates for d5c54h_.
(The format of our PDB-style files is described here.)

Timeline for d5c54h_: