Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Dihydrodipicolinate synthase [51574] (13 species) |
Species Campylobacter jejuni [TaxId:192222] [189204] (3 PDB entries) |
Domain d3lera_: 3ler A: [180235] automated match to d1o5ka_ complexed with acy, edo, fmt, mg, peg |
PDB Entry: 3ler (more details), 1.84 Å
SCOPe Domain Sequences for d3lera_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lera_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Campylobacter jejuni [TaxId: 192222]} mdkniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehr tcieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqgly ehykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvkeasgnidkcvdlla heprmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindel yninkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf
Timeline for d3lera_: