![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
![]() | Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) ![]() |
![]() | Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
![]() | Protein automated matches [226856] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries) |
![]() | Domain d5a36a2: 5a36 A:147-257 [318679] automated match to d2wa5a2 mutant |
PDB Entry: 5a36 (more details), 2 Å
SCOPe Domain Sequences for d5a36a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a36a2 a.40.1.0 (A:147-257) automated matches {Human (Homo sapiens) [TaxId: 9606]} sveetsakeglllwcqrktapyrnvniqnfhtswkdglglcalihrhrpdlidysklnkd dpigninlameiaekhldipkmldaedivntpkpderaimtyvscfyhafa
Timeline for d5a36a2: