Lineage for d2wa5a2 (2wa5 A:138-242)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.40: CH domain-like [47575] (3 superfamilies)
core: 4 helices: bundleSuperfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) 
Family a.40.1.0: automated matches [227151] (1 protein)
not a true familyProtein automated matches [226856] (4 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries) 
Domain d2wa5a2: 2wa5 A:138-242 [206736]
automated match to d1sh5a2
complexed with co3, so4
Details for d2wa5a2
PDB Entry: 2wa5 (more details), 1.9 Å
PDB Description: crystal structure of human filamin b actin binding domain at 1.9 angstroms resolution
PDB Compounds: (A:) Filamin-BSCOPe Domain Sequences for d2wa5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wa5a2 a.40.1.0 (A:138-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqtpkqrllgwiqnkipylpitnfnqnwqdgkalgalvdscapglcpdweswdpqkpvdn
areamqqaddwlgvpqvitpeeiihpdvdehsvmtylsqfpkakl
SCOPe Domain Coordinates for d2wa5a2:
Click to download the PDB-style file with coordinates for d2wa5a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2wa5a2:
- d2wa5a2 first appeared in SCOPe 2.03
- d2wa5a2 appears in SCOPe 2.06
- d2wa5a2 appears in the current release, SCOPe 2.08
View in 3D
