![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.1: Ribokinase-like [53614] (10 proteins) automatically mapped to Pfam PF00294 |
![]() | Protein Ribokinase [53615] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142709] (9 PDB entries) Uniprot Q9H477 15-322 |
![]() | Domain d5c3yl1: 5c3y L:14-322 [318601] Other proteins in same PDB: d5c3yb2, d5c3yc2, d5c3yd2, d5c3ye2, d5c3yf2, d5c3yg2, d5c3yh2, d5c3yi2, d5c3yj2, d5c3yk2, d5c3yl2 automated match to d2fv7a1 complexed with an2, na |
PDB Entry: 5c3y (more details), 2.6 Å
SCOPe Domain Sequences for d5c3yl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c3yl1 c.72.1.1 (L:14-322) Ribokinase {Human (Homo sapiens) [TaxId: 9606]} evaavvvvgscmtdlvsltsrlpktgetihghkffigfggkganqcvqaarlgamtsmvc kvgkdsfgndyienlkqndisteftyqtkdaatgtasiivnnegqniivivaganlllnt edlraaanvisrakvmvcqleitpatslealtmarrsgvktlfnpapaiadldpqfytls dvfccneseaeiltgltvgsaadageaalvllkrgcqvviitlgaegcvvlsqtepepkh iptekvkavdttgagdsfvgalafylayypnlsledmlnrsnfiaavsvqaagtqssypy kkdlpltlf
Timeline for d5c3yl1: