Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.3: Quinone reductase [52235] (4 proteins) binds FAD |
Protein automated matches [190235] (2 species) not a true protein |
Species Yersinia pestis [TaxId:214092] [195328] (2 PDB entries) |
Domain d5jroa1: 5jro A:1-201 [318582] Other proteins in same PDB: d5jroa2, d5jrob2 automated match to d1t5ba_ complexed with gol |
PDB Entry: 5jro (more details), 2.54 Å
SCOPe Domain Sequences for d5jroa1:
Sequence, based on SEQRES records: (download)
>d5jroa1 c.23.5.3 (A:1-201) automated matches {Yersinia pestis [TaxId: 214092]} mskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgalr psgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtfr ytekgpeglvtgkraiiltsrggihkdtptdlvvpylrlflgfigitdvefvfaegiayg pevatkaqadaktllaqvvaa
>d5jroa1 c.23.5.3 (A:1-201) automated matches {Yersinia pestis [TaxId: 214092]} mskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgalr pgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtfry tekgpeglvtgkraiiltsrgtptdlvvpylrlflgfigitdvefvfaegadaktllaqv vaa
Timeline for d5jroa1: