SCOPe 2.06: Domain d5iota_: 5iot A:

Lineage for d5iota_ (5iot A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
   complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354

4. Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families)
   automatically mapped to Pfam PF02511

5. Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)

6. Protein automated matches [191028] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [188837] (3 PDB entries)

8. Domain d5iota_: 5iot A: [318225]
   Other proteins in same PDB: d5iotb2
   automated match to d3g4cc_
   complexed with fad, ump

Details for d5iota_

PDB Entry: 5iot, 2 Å

PDB Description: flavin-dependent thymidylate synthase r174a variant in complex with fad and dump

PDB Compounds: (A:) Thymidylate synthase thyX

SCOPe Domain Sequences for d5iota_:

Sequence, based on SEQRES records:

>d5iota_ d.207.1.1 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlaadshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv

Sequence, based on observed residues (ATOM records):

>d5iota_ d.207.1.1 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mkidildkgfvelvdvmgndlsavraarvsfdeerdrhlieylmkhghetpfehivftfh
vkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervtekisei
vdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlaadshaqweiqq
yalaiarifkekcpwtfeaflkyaykgdilkevqv

Timeline for d5iota_:

• d5iota_ is new in SCOPe 2.06-stable
  
• d5iota_ appears in SCOPe 2.07
  
• d5iota_ appears in the current release, SCOPe 2.08