SCOP 1.55: Domain d1tkcb2: 1tkc B:338-534

Lineage for d1tkcb2 (1tkc B:338-534)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families)

5. Family c.36.1.2: Transketolase, TK [52528] (1 protein)

6. Protein Transketolase, TK [52529] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52530] (6 PDB entries)

8. Domain d1tkcb2: 1tkc B:338-534 [31814]
   Other proteins in same PDB: d1tkca3, d1tkcb3

Details for d1tkcb2

PDB Entry: 1tkc, 2.7 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate

SCOP Domain Sequences for d1tkcb2:

Sequence; same for both SEQRES and ATOM records:

>d1tkcb2 c.36.1.2 (B:338-534) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)}
lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf
qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa
lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles
khtpsiialsrqnlpql

Timeline for d1tkcb2:

• d1tkcb2 appears in SCOP 1.57
  
• d1tkcb2 appears in the current release, SCOPe 2.08