![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) ![]() |
![]() | Family c.36.1.2: Transketolase, TK [52528] (1 protein) |
![]() | Protein Transketolase, TK [52529] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52530] (6 PDB entries) |
![]() | Domain d1tkca2: 1tkc A:338-534 [31812] Other proteins in same PDB: d1tkca3, d1tkcb3 |
PDB Entry: 1tkc (more details), 2.7 Å
SCOP Domain Sequences for d1tkca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tkca2 c.36.1.2 (A:338-534) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)} lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles khtpsiialsrqnlpql
Timeline for d1tkca2: