SCOP 1.55: Domain d1tkcb3: 1tkc B:535-680

Lineage for d1tkcb3 (1tkc B:535-680)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.48: Transketolase C-terminal domain-like [52921] (1 superfamily)

4. Superfamily c.48.1: Transketolase C-terminal domain-like [52922] (3 families)

5. Family c.48.1.1: Transketolase [52923] (1 protein)

6. Protein Transketolase [52924] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (6 PDB entries)

8. Domain d1tkcb3: 1tkc B:535-680 [33095]
   Other proteins in same PDB: d1tkca1, d1tkca2, d1tkcb1, d1tkcb2

Details for d1tkcb3

PDB Entry: 1tkc, 2.7 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate

SCOP Domain Sequences for d1tkcb3:

Sequence; same for both SEQRES and ATOM records:

>d1tkcb3 c.48.1.1 (B:535-680) Transketolase {Baker's yeast (Saccharomyces cerevisiae)}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

Timeline for d1tkcb3:

• d1tkcb3 appears in SCOP 1.57
  
• d1tkcb3 appears in the current release, SCOPe 2.08