Lineage for d5jb8e_ (5jb8 E:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636083Protein Factor IX (IXa) [57198] (2 species)
  7. 2636084Species Human (Homo sapiens) [TaxId:9606] [57199] (29 PDB entries)
  8. 2636094Domain d5jb8e_: 5jb8 E: [318023]
    Other proteins in same PDB: d5jb8s_
    automated match to d2wphe_
    complexed with 0gj, ca, dms

Details for d5jb8e_

PDB Entry: 5jb8 (more details), 1.45 Å

PDB Description: crystal structure of factor ixa variant k98t in complex with egr- chloromethylketone
PDB Compounds: (E:) coagulation factor ix

SCOPe Domain Sequences for d5jb8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jb8e_ g.3.11.1 (E:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}
cnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvs

SCOPe Domain Coordinates for d5jb8e_:

Click to download the PDB-style file with coordinates for d5jb8e_.
(The format of our PDB-style files is described here.)

Timeline for d5jb8e_:

2636094
d5jb8e_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d5jb8s_