SCOPe 2.06: Domain d5hggb_: 5hgg B:

Lineage for d5hggb_ (5hgg B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (79 PDB entries)
   Uniprot P00749 156-178,179-424

8. Domain d5hggb_: 5hgg B: [317973]
   Other proteins in same PDB: d5hggs_, d5hggt_
   automated match to d4h42u_
   complexed with gol, mes, so4, twn

Details for d5hggb_

PDB Entry: 5hgg, 1.97 Å

PDB Description: crystal structure of upa in complex with a camelid-derived antibody fragment

PDB Compounds: (B:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d5hggb_:

Sequence; same for both SEQRES and ATOM records:

>d5hggb_ b.47.1.2 (B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtk

Timeline for d5hggb_:

• d5hggb_ is new in SCOPe 2.06-stable
  
• d5hggb_ appears in SCOPe 2.07
  
• d5hggb_ appears in the current release, SCOPe 2.08