Lineage for d5ewac_ (5ewa C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231217Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2231369Protein automated matches [190079] (9 species)
    not a true protein
  7. 2231487Species Serratia marcescens [TaxId:615] [186800] (5 PDB entries)
  8. 2231504Domain d5ewac_: 5ewa C: [317945]
    automated match to d1jjeb_
    complexed with 9bz, dms, edo, zn

Details for d5ewac_

PDB Entry: 5ewa (more details), 2.3 Å

PDB Description: crystal structure of the metallo-beta-lactamase imp-1 in complex with the bisthiazolidine inhibitor l-vc26
PDB Compounds: (C:) beta-lactamase imp-1

SCOPe Domain Sequences for d5ewac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ewac_ d.157.1.1 (C:) automated matches {Serratia marcescens [TaxId: 615]}
slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
fvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
lkskygkaklvvpshsevgdasllkltleqavkglneskkps

SCOPe Domain Coordinates for d5ewac_:

Click to download the PDB-style file with coordinates for d5ewac_.
(The format of our PDB-style files is described here.)

Timeline for d5ewac_: