Lineage for d5e2la_ (5e2l A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835910Family c.1.10.8: Class-II DAHP synthetase [141840] (2 proteins)
    Pfam PF01474
  6. 2835911Protein Probable DAHP synthetase AroG, phenylalanine-repressible [141841] (1 species)
  7. 2835912Species Mycobacterium tuberculosis [TaxId:1773] [141842] (11 PDB entries)
    Uniprot O53512 1-462
  8. 2835933Domain d5e2la_: 5e2l A: [317939]
    automated match to d3kgfa_
    complexed with cl, dpn, gol, mn, so4

Details for d5e2la_

PDB Entry: 5e2l (more details), 2.5 Å

PDB Description: 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis in complex with d-phenylalanine
PDB Compounds: (A:) 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase

SCOPe Domain Sequences for d5e2la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e2la_ c.1.10.8 (A:) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]}
mnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtv
pseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmp
vvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaam
nlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqt
aeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvia
npvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghq
viwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvtec
lggaqdisetdlagryetacdprlntqqslelaflvaemlrd

SCOPe Domain Coordinates for d5e2la_:

Click to download the PDB-style file with coordinates for d5e2la_.
(The format of our PDB-style files is described here.)

Timeline for d5e2la_: