Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.8: Class-II DAHP synthetase [141840] (2 proteins) Pfam PF01474 |
Protein Probable DAHP synthetase AroG, phenylalanine-repressible [141841] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [141842] (11 PDB entries) Uniprot O53512 1-462 |
Domain d5e2la_: 5e2l A: [317939] automated match to d3kgfa_ complexed with cl, dpn, gol, mn, so4 |
PDB Entry: 5e2l (more details), 2.5 Å
SCOPe Domain Sequences for d5e2la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e2la_ c.1.10.8 (A:) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]} mnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtv pseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmp vvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaam nlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqt aeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvia npvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghq viwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvtec lggaqdisetdlagryetacdprlntqqslelaflvaemlrd
Timeline for d5e2la_: