![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (17 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
![]() | Domain d5fk9a2: 5fk9 A:114-203 [317761] Other proteins in same PDB: d5fk9a1, d5fk9b1, d5fk9b2, d5fk9c1, d5fk9c2 automated match to d4eura2 mutant |
PDB Entry: 5fk9 (more details), 3.1 Å
SCOPe Domain Sequences for d5fk9a2:
Sequence, based on SEQRES records: (download)
>d5fk9a2 b.1.1.2 (A:114-203) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffpsp
>d5fk9a2 b.1.1.2 (A:114-203) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrdfksnsav awsnksdfacanafnnsiipedtffpsp
Timeline for d5fk9a2:
![]() Domains from other chains: (mouse over for more information) d5fk9b1, d5fk9b2, d5fk9c1, d5fk9c2 |