SCOPe 2.07: Domain d5fk9a2: 5fk9 A:114-203

Lineage for d5fk9a2 (5fk9 A:114-203)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d5fk9a2: 5fk9 A:114-203 [317761]
   Other proteins in same PDB: d5fk9a1, d5fk9b1, d5fk9b2, d5fk9c1, d5fk9c2
   automated match to d4eura2
   mutant

Details for d5fk9a2

PDB Entry: 5fk9, 3.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin a f47a mutant in complex with a t cell receptor

PDB Compounds: (A:) T cell receptor alpha chain

SCOPe Domain Sequences for d5fk9a2:

Sequence, based on SEQRES records:

>d5fk9a2 b.1.1.2 (A:114-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Sequence, based on observed residues (ATOM records):

>d5fk9a2 b.1.1.2 (A:114-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrdfksnsav
awsnksdfacanafnnsiipedtffpsp

Timeline for d5fk9a2:

• d5fk9a2 first appeared in SCOPe 2.06
  
• d5fk9a2 appears in the current release, SCOPe 2.08