SCOPe 2.07: Domain d5fk9c1: 5fk9 C:12-120

Lineage for d5fk9c1 (5fk9 C:12-120)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein automated matches [226992] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225594] (2 PDB entries)

8. Domain d5fk9c1: 5fk9 C:12-120 [317886]
   Other proteins in same PDB: d5fk9a1, d5fk9a2, d5fk9b1, d5fk9b2, d5fk9c2
   automated match to d1esfa1
   mutant

Details for d5fk9c1

PDB Entry: 5fk9, 3.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin a f47a mutant in complex with a t cell receptor

PDB Compounds: (C:) enterotoxin type a

SCOPe Domain Sequences for d5fk9c1:

Sequence, based on SEQRES records:

>d5fk9c1 b.40.2.2 (C:12-120) automated matches {Staphylococcus aureus [TaxId: 1280]}
lrkkselqgtalgnlkqiyyynekaktenkeshdqalqhtilfkgfftdhswyndllvdf
dskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

Sequence, based on observed residues (ATOM records):

>d5fk9c1 b.40.2.2 (C:12-120) automated matches {Staphylococcus aureus [TaxId: 1280]}
lrkkselqgtalgnlkqiyyynekaktenkeshdhtilfkgfftdhswyndllvdfdskd
ivdkykgkkvdlygayygyqcagpnktacmyggvtlhdnnrlt

Timeline for d5fk9c1:

• d5fk9c1 first appeared in SCOPe 2.06
  
• d5fk9c1 appears in the current release, SCOPe 2.08