Lineage for d5jqgd2 (5jqg D:244-431)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201405Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2201498Protein Tubulin beta-subunit [55313] (2 species)
  7. 2201499Species Cow (Bos taurus) [TaxId:9913] [64322] (11 PDB entries)
    Uniprot P02554
  8. 2201501Domain d5jqgd2: 5jqg D:244-431 [317584]
    Other proteins in same PDB: d5jqga1, d5jqga2, d5jqgb1, d5jqgc1, d5jqgc2, d5jqgd1, d5jqge_, d5jqgf1, d5jqgf2
    automated match to d1sa0b2
    complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d5jqgd2

PDB Entry: 5jqg (more details), 2.24 Å

PDB Description: an apo tubulin-rb-ttl complex structure used for side-by-side comparison
PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d5jqgd2:

Sequence, based on SEQRES records: (download)

>d5jqgd2 d.79.2.1 (D:244-431) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d5jqgd2 d.79.2.1 (D:244-431) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdaknmmaacdprhgryltv
aavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

SCOPe Domain Coordinates for d5jqgd2:

Click to download the PDB-style file with coordinates for d5jqgd2.
(The format of our PDB-style files is described here.)

Timeline for d5jqgd2: