Lineage for d5axra_ (5axr A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231713Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2231714Protein automated matches [190418] (18 species)
    not a true protein
  7. 2231907Species Serratia marcescens [TaxId:615] [193993] (7 PDB entries)
  8. 2231913Domain d5axra_: 5axr A: [317383]
    automated match to d4ax1b_
    complexed with com, na, zn

Details for d5axra_

PDB Entry: 5axr (more details), 2.1 Å

PDB Description: crystal structure of metallo-beta-lactamase smb-1 bound to 2- mercaptoethanesulfonate
PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d5axra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5axra_ d.157.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]}
rdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgfkl
sdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgslsnfpg
sakvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavsad
syrfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdngac
raiaaagrkrletrlasek

SCOPe Domain Coordinates for d5axra_:

Click to download the PDB-style file with coordinates for d5axra_.
(The format of our PDB-style files is described here.)

Timeline for d5axra_: