Lineage for d4zpaa_ (4zpa A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2623022Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 2623336Protein automated matches [190260] (25 species)
    not a true protein
  7. 2623345Species Coxsackievirus b3 [TaxId:12072] [271111] (10 PDB entries)
  8. 2623353Domain d4zpaa_: 4zpa A: [317316]
    automated match to d4nlya_
    complexed with so4; mutant

Details for d4zpaa_

PDB Entry: 4zpa (more details), 2.67 Å

PDB Description: coxsackievirus b3 polymerase - f364y mutant
PDB Compounds: (A:) RNA-directed RNA polymerase

SCOPe Domain Sequences for d4zpaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zpaa_ e.8.1.4 (A:) automated matches {Coxsackievirus b3 [TaxId: 12072]}
geiefiesskdagfpvintpsktklepsvfhqvfegnkepavlrsgdprlkanfeeaifs
kyignvnthvdeymleavdhyagqlatldistepmkledavygteglealdlttsagypy
valgikkrdilskktkdltklkecmdkyglnlpmvtyvkdelrsiekvakgksrlieass
lndsvamrqtfgnlyktfhlnpgvvtgsavgcdpdlfwskipvmldghliafdysgydas
lspvwfaclkmileklgythketnyidylcnshhlyrdkhyfvrggmpsgcsgtsifnsm
inniiirtlmlkvykgidldqfrmiaygddviasypwpidasllaeagkgyglimtpadk
gecynevtwtnvtflkryfradeqypflvhpvmpmkdihesirwtkdpkntqdhvrslcl
lawhngeheyeefirkirsvpvgrcltlpafstlrrkwldsf

SCOPe Domain Coordinates for d4zpaa_:

Click to download the PDB-style file with coordinates for d4zpaa_.
(The format of our PDB-style files is described here.)

Timeline for d4zpaa_: