SCOPe 2.07: Domain d5e0ga1: 5e0g A:1-173

Lineage for d5e0ga1 (5e0g A:1-173)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Norwalk virus [TaxId:524364] [313606] (14 PDB entries)

8. Domain d5e0ga1: 5e0g A:1-173 [316914]
   Other proteins in same PDB: d5e0ga2
   automated match to d2fyqa_
   complexed with 5lg, cl

Details for d5e0ga1

PDB Entry: 5e0g, 1.2 Å

PDB Description: 1.20 a resolution structure of norovirus 3cl protease in complex with a triazole-based macrocyclic (17-mer) inhibitor

PDB Compounds: (A:) Norovirus 3C-like protease

SCOPe Domain Sequences for d5e0ga1:

Sequence, based on SEQRES records:

>d5e0ga1 b.47.1.4 (A:1-173) automated matches {Norwalk virus [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa

Sequence, based on observed residues (ATOM records):

>d5e0ga1 b.47.1.4 (A:1-173) automated matches {Norwalk virus [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakglgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa

Timeline for d5e0ga1:

• d5e0ga1 first appeared in SCOPe 2.06
  
• d5e0ga1 appears in the current release, SCOPe 2.08